PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do012080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 420aa    MW: 43905.2 Da    PI: 5.1442
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do012080.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA565.2e-18337370134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 C++C+  kTp+WR gp g+ktLCnaCG++y++ +
  Do012080.1 337 CTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGR 370
                 *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.47E-14330393No hitNo description
PROSITE profilePS5011411.082331367IPR000679Zinc finger, GATA-type
SMARTSM004011.6E-15331381IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.4E-14335368IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.93E-14336393No hitNo description
PROSITE patternPS003440337362IPR000679Zinc finger, GATA-type
PfamPF003201.2E-15337370IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MASGGFVEEM MREQSLLEAT CGDLFDHIDD LLDFPKEDSA ADVLLLDAPA PGSPLSARII  60
DVGGRCNAPS APQAPPAAME PLMALPPPAA QDDAAAFFAA AGAPVFDAKD VGGHIGSCED  120
LDMDMAQLEW LSGLFDDASI PHEPAFPGAN CAAPIKSSAL AANAGVALLP PDKMEDALFR  180
SSSPISVFVH NSFNANNNVG SASSSSSSAS SSSESFSGSG GHAWSAPVSP RPEPPVLVIP  240
ARARSKRSRP SAFTGAARAA EAPTILVPTP MYSSTSSHSD PESIAESNPA PPMKKKKAKK  300
PAPPAPAASD ADGDNDGDAD YEEGSERALP PGTVRRCTHC QIEKTPQWRA GPLGPKTLCN  360
ACGVRYKSGR LFPEYRPAAS PTFVPSIHSN SHKKVVEMRQ KAVRSGDPSC DLLQFIRRRD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9662110.0EU966211.1 Zea mays clone 292603 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954283.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_004954284.10.0PREDICTED: GATA transcription factor 8-like
TrEMBLK3YSS20.0K3YSS2_SETIT; Uncharacterized protein
STRINGSi017314m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51693451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.26e-37GATA family protein